Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Contact
Send Us a Message
Your Name is a required field
Your Email is a required field
Message cannot be blank



Fertility, conceiving
Fertility, Conceiving
Fertility, conceiving
£60.00
Add To Cart
Are you struggling to become pregnant, does it seem like an up hill struggle? Have you exhausted all...
Stop Smoking
Stop Smoking
Stop Smoking
£150.00
Add To Cart
Do you feel now is the time that you want to STOP smoking. Have you imagined what it would be like to...
Hypno for war heroes
Hypno for war heroes
Hypno for war heroes
£30.00
Add To Cart
What is PTSD? Of course, feeling fear when facing a scary or potentially dangerous situation is entirely...
Clinical Hypnotherapy
Clinical Hypnotherapy
Clinical Hypnotherapy
£0.01
Add To Cart
Clinical Hypnotherapy Have you discussed hypnotherapy with your GP? If you are considering discussing...
Stress, Anxiety
Stress, Anxiety
Stress, Anxiety
£60.00
Add To Cart
We go through our daily lives with having demands placed on us. Eventually this can lead to having a...
Popular Products
Monday          10.00 -17.00                                                                                                                                   10.00 - 17.00
Tuesday         10.00 - 1700                                                                                                                                                                                                        10.00 - 17.00             
Wednesday    10.00 - 17.00                                                                                                                          10:00 - 17:00
Thursday       10.00 - 17.00                                                                                                                              09:00 - 18:00
Friday            10.00 - 17.00                                                                                                                           10:00 - 17.00
Saturday & Sunday  - Closed                                                                                                                                                                                                                  Closed
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i