Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Contact
Send Us a Message
Your Name is a required field
Your Email is a required field
Message cannot be blank



Hypno for war heroes
Hypno for war heroes
Hypno for war heroes
£40.00
Add To Cart
What is PTSD? Of course, feeling fear when facing a scary or potentially dangerous situation is entirely...
past life regression
Past life regression
past life regression
£70.00
Add To Cart
Have you lived before? Are you curious about past lives? Do you want to know who you were in a past life?...
Stress, Anxiety
Stress, Anxiety
Stress, Anxiety
£80.00
Add To Cart
We go through our daily lives with having demands placed on us. Eventually this can lead to having a...
Stop Smoking
Stop Smoking
Stop Smoking
£160.00
Add To Cart
Do you feel now is the time that you want to STOP smoking. Have you imagined what it would be like to...
Popular Products
Monday          10.00 -17.00                                                                                                                                   10.00 - 17.00
Tuesday         10.00 - 1700                                                                                                                                                                                                        10.00 - 17.00             
Wednesday    10.00 - 17.00                                                                                                                          10:00 - 17:00
Thursday       10.00 - 17.00                                                                                                                              09:00 - 18:00
Friday            10.00 - 17.00                                                                                                                           10:00 - 17.00
Saturday & Sunday  - Closed                                                                                                                                                                                                                  Closed
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i