Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Contact
Send Us a Message
Your Name is a required field
Your Email is a required field
Message cannot be blank



Fertility, conceiving
Fertility, Conceiving
Fertility, conceiving
£60.00
Add To Cart
Are you struggling to become pregnant, does it seem like an up hill struggle? Have you exhausted all...
Stress, Anxiety
Stress, Anxiety
Stress, Anxiety
£60.00
Add To Cart
We go through our daily lives with having demands placed on us. Eventually this can lead to having a...
Fear, Phobias
Fear, Phobias
Fear, Phobias
£60.00
Add To Cart
Fear is a natural response caused by real danger. For example we are all scared of coming face to face...
Clinical Hypnotherapy
Clinical Hypnotherapy
Clinical Hypnotherapy
£0.01
Add To Cart
Clinical Hypnotherapy Have you discussed hypnotherapy with your GP? If you are considering discussing...
Popular Products
Monday          10.00 -17.00                                                                                                                                   10.00 - 17.00
Tuesday         10.00 - 1700                                                                                                                                                                                                        10.00 - 17.00             
Wednesday    10.00 - 17.00                                                                                                                          10:00 - 17:00
Thursday       10.00 - 17.00                                                                                                                              09:00 - 18:00
Friday            10.00 - 17.00                                                                                                                           10:00 - 17.00
Saturday & Sunday  - Closed                                                                                                                                                                                                                  Closed
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i